PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_06345.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 411aa    MW: 46845.9 Da    PI: 7.1835
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_06345.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.75.8e-50351602128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                              +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg
  Sme2.5_06345.1_g00005.1  35 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATG 119
                              79***************************.89***************8778899******************************** PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               d+ + +++++ +glkktLvfy+g+apkg +++W+m+eyrl
  Sme2.5_06345.1_g00005.1 120 ADRMIRTENSRSIGLKKTLVFYSGKAPKGIRSSWIMNEYRL 160
                              ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-5534180IPR003441NAC domain
PROSITE profilePS5100556.00234181IPR003441NAC domain
PfamPF023654.8E-2536160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MSQSQQQQED DNIIINNNDN NAIKGDDDHE HDMVMPGFRF HPTEEELVEF YLRRKVEGKR  60
FNVELITFLD LYRYDPWELP ALAAIGEKEW YFYVPRDRKY RNGDRPNRVT TSGYWKATGA  120
DRMIRTENSR SIGLKKTLVF YSGKAPKGIR SSWIMNEYRL PHHETERLQK AEISLCRVYK  180
RAGVEDHPSL PRSLLTTRAS SSSPSRGTTS IKKQQVAQQD SSLISPLYGG QSSQQQMEEK  240
LSTETSASST STDHHHHHQH HHHHVATSLG LNSLSNSYTN ISLDPIGGNA VTSSLNLTTS  300
NLTPFTSLVA TTNNTDDLHR LINIDQVVAF HNNQHHFHNN PINHHPPVVV SQQFPPLLLQ  360
QPQLAPPQQS LLLQGSLQSS AFSDRLWEWN SINQTDASCK DDHYQANNPF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-563618119165NAC domain-containing protein 19
4dul_A2e-563618119165NAC domain-containing protein 19
1ut7_B2e-563618119165NO APICAL MERISTEM PROTEIN
1ut7_A2e-563618119165NO APICAL MERISTEM PROTEIN
1ut4_B2e-563618119165NO APICAL MERISTEM PROTEIN
1ut4_A2e-563618119165NO APICAL MERISTEM PROTEIN
3swp_D3e-563618122168NAC domain-containing protein 19
3swp_C3e-563618122168NAC domain-containing protein 19
3swp_B3e-563618122168NAC domain-containing protein 19
3swp_A3e-563618122168NAC domain-containing protein 19
3swm_D3e-563618122168NAC domain-containing protein 19
3swm_C3e-563618122168NAC domain-containing protein 19
3swm_B3e-563618122168NAC domain-containing protein 19
3swm_A3e-563618122168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2385081e-128AC238508.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-43d23 map 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010314156.10.0PREDICTED: NAC domain-containing protein 55 isoform X1
TrEMBLM1BK160.0M1BK16_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000470210.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-109NAC domain containing protein 35